Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Pyr3) -Amyloid β-Protein (3-42) (TFA)

(Pyr3) -Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3) -Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.

Product Specifications

Field of Research

Neuroscience; Immunology & Inflammation

Purity

≥95%

Molecular Weight

4309.86

Notes

For research use only.

AA Sequence

{Pyr}-FRHDSGYVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACH000143 100mg
A22524-100 100 mg

ACH000143 100mg

Sign In for Pricing
View Details
MGAT1 Polyclonal Antibody
CAC13115-01 50 µL

MGAT1 Polyclonal Antibody

Sign In for Pricing
View Details
MGAT1 Polyclonal Antibody
CAC13115-02 100 µL

MGAT1 Polyclonal Antibody

Sign In for Pricing
View Details
SEPT7P3 ORF Vector (Human) (pORF)
ORF032160 1.0 µg DNA

SEPT7P3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human ERBB2 protein, His Tag, FITC-Labeled
IMP-605 25 µg

Recombinant Human ERBB2 protein, His Tag, FITC-Labeled

Sign In for Pricing
View Details
Methyl 4-hydroxyphenylacetate
FM38911-01 100 g

Methyl 4-hydroxyphenylacetate

Sign In for Pricing
View Details