Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Pyr3) -Amyloid β-Protein (3-42) (TFA)

(Pyr3) -Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3) -Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.

Product Specifications

Field of Research

Neuroscience; Immunology & Inflammation

Purity

≥95%

Molecular Weight

4309.86

Notes

For research use only.

AA Sequence

{Pyr}-FRHDSGYVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGLS Human Over-expression Lysate
orb1367809 20 µg

PGLS Human Over-expression Lysate

Sign In for Pricing
View Details
Sheep Stomach Total Protein
ST-302 1 mg

Sheep Stomach Total Protein

Sign In for Pricing
View Details
Recombinant Human Collagen alpha-1 protein (COL15A1)
MBS9422941-01 0.02 mg

Recombinant Human Collagen alpha-1 protein (COL15A1)

Sign In for Pricing
View Details
Recombinant Human Collagen alpha-1 protein (COL15A1)
MBS9422941-02 0.1 mg

Recombinant Human Collagen alpha-1 protein (COL15A1)

Sign In for Pricing
View Details
Recombinant Human Collagen alpha-1 protein (COL15A1)
MBS9422941-03 0.25 mg

Recombinant Human Collagen alpha-1 protein (COL15A1)

Sign In for Pricing
View Details
Recombinant Human Collagen alpha-1 protein (COL15A1)
MBS9422941-04 0.5 mg

Recombinant Human Collagen alpha-1 protein (COL15A1)

Sign In for Pricing
View Details