Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Pyr3) -Amyloid β-Protein (3-42) (TFA)

(Pyr3) -Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3) -Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.

Product Specifications

Field of Research

Neuroscience; Immunology & Inflammation

Purity

≥95%

Molecular Weight

4309.86

Notes

For research use only.

AA Sequence

{Pyr}-FRHDSGYVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ATP2C1 Protein, C-His
YHF80502 100 μg

Recombinant Human ATP2C1 Protein, C-His

Sign In for Pricing
View Details
C22orf29 Polyclonal Antibody
MBS9235394-01 0.1 mL

C22orf29 Polyclonal Antibody

Sign In for Pricing
View Details
C22orf29 Polyclonal Antibody
MBS9235394-02 5x 0.1 mL

C22orf29 Polyclonal Antibody

Sign In for Pricing
View Details
SLC22A25 (NM_199352) Human Tagged ORF Clone Lentiviral Particle
RC223323L3V 200 µL

SLC22A25 (NM_199352) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GORASP2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV666569 1.0 µg DNA

GORASP2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Angiopoietin-1 Recombinant Antibody, Biotin Conjugated
bsm-61282R-Biotin-TR 20 µL

Angiopoietin-1 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details