(Pyr3) -Amyloid β-Protein (3-42) (TFA)
(Pyr3) -Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3) -Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.
Product Specifications
Field of Research
Neuroscience; Immunology & Inflammation
Purity
≥95%
Molecular Weight
4309.86
Notes
For research use only.
AA Sequence
{Pyr}-FRHDSGYVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog