Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Pyr3) -Amyloid β-Protein (3-42) (TFA)

(Pyr3) -Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3) -Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.

Product Specifications

Field of Research

Neuroscience; Immunology & Inflammation

Purity

≥95%

Molecular Weight

4309.86

Notes

For research use only.

AA Sequence

{Pyr}-FRHDSGYVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1S) -2-chloro-1- (4-cyclohexylphenyl) ethanol
sc-339333 1 g

(1S) -2-chloro-1- (4-cyclohexylphenyl) ethanol

Sign In for Pricing
View Details
CA4, CT (Carbonic Anhydrase 4, Carbonic Anhydrase IV, CA-IV, Carbonate Dehydratase IV) (Biotin)
MBS6467011-01 0.2 mL

CA4, CT (Carbonic Anhydrase 4, Carbonic Anhydrase IV, CA-IV, Carbonate Dehydratase IV) (Biotin)

Sign In for Pricing
View Details
CA4, CT (Carbonic Anhydrase 4, Carbonic Anhydrase IV, CA-IV, Carbonate Dehydratase IV) (Biotin)
MBS6467011-02 5x 0.2 mL

CA4, CT (Carbonic Anhydrase 4, Carbonic Anhydrase IV, CA-IV, Carbonate Dehydratase IV) (Biotin)

Sign In for Pricing
View Details
Hexaphenylbenzene
JH599125 1 Each

Hexaphenylbenzene

Sign In for Pricing
View Details
Lentiviral mouse Zbtb21 shRNA (UAS) - Lentiviral mouse Zbtb21 shRNA (UAS) plasmid
GTR15210943 1 Vial

Lentiviral mouse Zbtb21 shRNA (UAS) - Lentiviral mouse Zbtb21 shRNA (UAS) plasmid

Sign In for Pricing
View Details
PTX3 siRNA (Mouse)
MBS8210416-01 15 nmol

PTX3 siRNA (Mouse)

Sign In for Pricing
View Details