Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Pyr11]-Amyloid β-Protein (11-40)

(Pyr11) -Amyloid β-Protein (11-40) (A beta 11pE-40) is a peptide. (Pyr11) -Amyloid β-Protein (11-40) can be used for the research of Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3133.71

Notes

For research use only.

AA Sequence

{Pyr}-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF740 conjugate, 0.1mg/mL
BNC740743-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Mkks activation kit by CRISPRa
GA206343 1 Kit

Mouse Mkks activation kit by CRISPRa

Sign In for Pricing
View Details
PCDHGA2 CytoSection
TS410863P5 25 Slides

PCDHGA2 CytoSection

Sign In for Pricing
View Details
Beta crystallin S (CRYGS) (NM_017541) Human Recombinant Protein
TP310159 20 µg

Beta crystallin S (CRYGS) (NM_017541) Human Recombinant Protein

Sign In for Pricing
View Details
Human DISP2 activation kit by CRISPRa
GA113894 1 Kit

Human DISP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), 0.2mg/mL
BNUB2284-100 1x 100 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), 0.2mg/mL

Sign In for Pricing
View Details