Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Pyr11]-Amyloid β-Protein (11-40)

(Pyr11) -Amyloid β-Protein (11-40) (A beta 11pE-40) is a peptide. (Pyr11) -Amyloid β-Protein (11-40) can be used for the research of Alzheimer's disease.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

3133.71

Notes

For research use only.

AA Sequence

{Pyr}-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCP1B Mouse Monoclonal Antibody [Clone ID: OTI2D8]
CF809932 100 µg

DCP1B Mouse Monoclonal Antibody [Clone ID: OTI2D8]

Sign In for Pricing
View Details
HNRNPD (NM_002138) Human Over-expression Lysate
LC419510 20 µg

HNRNPD (NM_002138) Human Over-expression Lysate

Sign In for Pricing
View Details
Biocytin *CAS 576-19-2*
3080-AAT 100 mg

Biocytin *CAS 576-19-2*

Sign In for Pricing
View Details
Nitrendipine Propyl Ester
TRC-N490170-10MG 10 mg

Nitrendipine Propyl Ester

Sign In for Pricing
View Details
HSV-2 TaqMan Probe/Primer and Control Set
TM32410 100 Reactions

HSV-2 TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
GUSBP5 (NM_001011539) Human Over-expression Lysate
LC423268 20 µg

GUSBP5 (NM_001011539) Human Over-expression Lysate

Sign In for Pricing
View Details