Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Decorsin, Leech

Decorsin, Leech

Product Specifications

Purity

≥95%

Molecular Weight

4383.87

Notes

For research use only.

AA Sequence

APRLPQCQGDDQEKCLCNKDECPPGQCRFPRGDADPYCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT34 rabbit pAb Antibody
orb772067-01 50 μL

KRT34 rabbit pAb Antibody

Sign In for Pricing
View Details
KRT34 rabbit pAb Antibody
orb772067-02 100 µL

KRT34 rabbit pAb Antibody

Sign In for Pricing
View Details
Fmoc-Lys(Mtt)-OH
4154783.0005 5 g

Fmoc-Lys(Mtt)-OH

Sign In for Pricing
View Details
CD11c Antibody
V2643-100UG 100 µg

CD11c Antibody

Sign In for Pricing
View Details
IFI6 (N-Term) Rabbit pAb
MBS8556755-01 0.1 mL

IFI6 (N-Term) Rabbit pAb

Sign In for Pricing
View Details
IFI6 (N-Term) Rabbit pAb
MBS8556755-02 0.1 mL (AF405L)

IFI6 (N-Term) Rabbit pAb

Sign In for Pricing
View Details