Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHM-27/PHI, human

PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid) . PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Solubility

DMSO: 100 mg/mL

Molecular Weight

2985.48

Notes

For research use only.

AA Sequence

HADGVFTSDFSKLLGQLSAKKYLESLM-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab32 (NM_026405) Mouse Tagged ORF Clone Lentiviral Particle
MR202577L3V 200 µL

Rab32 (NM_026405) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VAMP7 antibody
70R-8715 100 µL

VAMP7 antibody

Sign In for Pricing
View Details
Mouse Monoclonal C16orf72 Antibody (OTI2D1) [PerCP]
NBP2-71842PCP 0.1 mL

Mouse Monoclonal C16orf72 Antibody (OTI2D1) [PerCP]

Sign In for Pricing
View Details
Lentiviral human TEX15 sgRNA gene knockout kit - Lentiviral human TEX15 sgRNA gene knockout kit (25)
GTR15391095 1 Vial

Lentiviral human TEX15 sgRNA gene knockout kit - Lentiviral human TEX15 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Human COL4 (Collagen Type IV) CLIA Kit
E-CL-H0162-01 24 Tests

Human COL4 (Collagen Type IV) CLIA Kit

Sign In for Pricing
View Details
Human COL4 (Collagen Type IV) CLIA Kit
E-CL-H0162-02 48 Tests

Human COL4 (Collagen Type IV) CLIA Kit

Sign In for Pricing
View Details