Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHM-27/PHI, human

PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid) . PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Solubility

DMSO: 100 mg/mL

Molecular Weight

2985.48

Notes

For research use only.

AA Sequence

HADGVFTSDFSKLLGQLSAKKYLESLM-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-beta Catenin (Ser37) Rabbit Polyclonal Antibody (BF405)
orb1603316 100 µL

Phospho-beta Catenin (Ser37) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)
MBS1243589-01 0.02 mg (E-Coli)

Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)
MBS1243589-02 0.02 mg (Yeast)

Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)
MBS1243589-03 0.1 mg (E-Coli)

Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)
MBS1243589-04 0.1 mg (Yeast)

Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)
MBS1243589-05 0.02 mg (Baculovirus)

Recombinant Archaeoglobus fulgidus Phosphoribosylamine--glycine ligase (purD)

Sign In for Pricing
View Details