Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lytic Peptide, SB – 37

Lytic Peptide, SB – 37

Product Specifications

Purity

≥95%

Molecular Weight

4089.05

Notes

For research use only.

AA Sequence

MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EpTIPS Rack G 0.1-5mL epQua 120
E0030071638 120 / PCK

EpTIPS Rack G 0.1-5mL epQua 120

Sign In for Pricing
View Details
Gas7 ORF Vector (Rat) (pORF)
ORF067423 1.0 µg DNA

Gas7 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Guinea Pig anti-Alpha Melanocyte Stimulating Hormone antibody ELISA Kit
MBS7274152-01 48 Well

Guinea Pig anti-Alpha Melanocyte Stimulating Hormone antibody ELISA Kit

Sign In for Pricing
View Details
Guinea Pig anti-Alpha Melanocyte Stimulating Hormone antibody ELISA Kit
MBS7274152-02 96 Well

Guinea Pig anti-Alpha Melanocyte Stimulating Hormone antibody ELISA Kit

Sign In for Pricing
View Details
Guinea Pig anti-Alpha Melanocyte Stimulating Hormone antibody ELISA Kit
MBS7274152-03 5x 96 Well

Guinea Pig anti-Alpha Melanocyte Stimulating Hormone antibody ELISA Kit

Sign In for Pricing
View Details
Guinea Pig anti-Alpha Melanocyte Stimulating Hormone antibody ELISA Kit
MBS7274152-04 10x 96 Well

Guinea Pig anti-Alpha Melanocyte Stimulating Hormone antibody ELISA Kit

Sign In for Pricing
View Details