Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

α-Defensin-1, human

α-Defensin-1, human

Product Specifications

Purity

≥95%

Molecular Weight

3928.58

Notes

For research use only.

AA Sequence

DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: Cys5- Cys34, Cys12-Cys27, Cys17-Cys35)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF Antibody
A43183-50UG 50 µg

TNF Antibody

Sign In for Pricing
View Details
PPP1R3A (NM_002711) Human Tagged ORF Clone Lentiviral Particle
RC215004L3V 200 µL

PPP1R3A (NM_002711) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ITGA2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1103105 3x 1.0 µg

ITGA2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CORO1B siRNA (Mouse)
orb1844761-01 15 nmol

CORO1B siRNA (Mouse)

Sign In for Pricing
View Details
CORO1B siRNA (Mouse)
orb1844761-02 30 nmol

CORO1B siRNA (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Sult1c1 shRNA (UAS) - Lentiviral mouse Sult1c1 shRNA (UAS, GFP) (100)
GTR15225969 1 Vial

Lentiviral mouse Sult1c1 shRNA (UAS) - Lentiviral mouse Sult1c1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details