Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

α-Defensin-1, human

α-Defensin-1, human

Product Specifications

Purity

≥95%

Molecular Weight

3928.58

Notes

For research use only.

AA Sequence

DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: Cys5- Cys34, Cys12-Cys27, Cys17-Cys35)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRD9 ligand-7
HY-168695 1 Each

BRD9 ligand-7

Sign In for Pricing
View Details
2B4 Protein (C-Human Fc Tag, )
P510123 100 µg

2B4 Protein (C-Human Fc Tag, )

Sign In for Pricing
View Details
SYTL5 Rabbit Polyclonal Antibody (BF555)
orb2422335 100 µL

SYTL5 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
FOSL2 (FOS-like antigen 2, FLJ23306, FRA2) (MaxLight 750)
MBS6238265-01 0.1 mL

FOSL2 (FOS-like antigen 2, FLJ23306, FRA2) (MaxLight 750)

Sign In for Pricing
View Details
FOSL2 (FOS-like antigen 2, FLJ23306, FRA2) (MaxLight 750)
MBS6238265-02 5x 0.1 mL

FOSL2 (FOS-like antigen 2, FLJ23306, FRA2) (MaxLight 750)

Sign In for Pricing
View Details
FASN, ID (FAS, Fatty Acid Synthase) (PE) discontinued
F0020-11A-PE 200 µL

FASN, ID (FAS, Fatty Acid Synthase) (PE) discontinued

Sign In for Pricing
View Details