Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

α-Defensin-1, human

α-Defensin-1, human

Product Specifications

Purity

≥95%

Molecular Weight

3928.58

Notes

For research use only.

AA Sequence

DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: Cys5- Cys34, Cys12-Cys27, Cys17-Cys35)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Recombinant Mouse Tigit, Fc-tagged
Tigit-108M 50 µg

Active Recombinant Mouse Tigit, Fc-tagged

Sign In for Pricing
View Details
TAS2R43 Antibody
MBS9508399-01 0.05 mL

TAS2R43 Antibody

Sign In for Pricing
View Details
TAS2R43 Antibody
MBS9508399-02 0.1 mL

TAS2R43 Antibody

Sign In for Pricing
View Details
TAS2R43 Antibody
MBS9508399-03 5x 0.1 mL

TAS2R43 Antibody

Sign In for Pricing
View Details
3-Phenyl-1-butanol
TRC-P309010-250MG 250 mg

3-Phenyl-1-butanol

Sign In for Pricing
View Details
Recombinant Manduca sexta Ommochrome-binding protein
MBS1162244-01 0.02 mg (E-Coli)

Recombinant Manduca sexta Ommochrome-binding protein

Sign In for Pricing
View Details