Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Defensin (human) HNP-2

Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.

Product Specifications

Purity

≥95%

Molecular Weight

3371.02

Notes

For research use only.

AA Sequence

CYCRIPACIAGERRYGTCIYGTCIYQGRLWAFCC (Disulfide bridge: Cys1- Cys29, Cys3- Cys18, Cys8- Cys28)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF4A, phosphorylated (S304) (Hepatocyte Nuclear Factor 4 Alpha, TCF, HNF4, MODY, MODY1, NR2A1, TCF14, HNF4a7, HNF4a8, HNF4a9, NR2A21, HNF4alpha) discontinued
211318-01 20 µL

HNF4A, phosphorylated (S304) (Hepatocyte Nuclear Factor 4 Alpha, TCF, HNF4, MODY, MODY1, NR2A1, TCF14, HNF4a7, HNF4a8, HNF4a9, NR2A21, HNF4alpha) discontinued

Sign In for Pricing
View Details
HNF4A, phosphorylated (S304) (Hepatocyte Nuclear Factor 4 Alpha, TCF, HNF4, MODY, MODY1, NR2A1, TCF14, HNF4a7, HNF4a8, HNF4a9, NR2A21, HNF4alpha) discontinued
211318-02 100 µL

HNF4A, phosphorylated (S304) (Hepatocyte Nuclear Factor 4 Alpha, TCF, HNF4, MODY, MODY1, NR2A1, TCF14, HNF4a7, HNF4a8, HNF4a9, NR2A21, HNF4alpha) discontinued

Sign In for Pricing
View Details
SMAP1 (NM_021940) Human Tagged ORF Clone
RC224031 10 µg

SMAP1 (NM_021940) Human Tagged ORF Clone

Sign In for Pricing
View Details
Neomycin N 10 µg
9287/2 250 Discs

Neomycin N 10 µg

Sign In for Pricing
View Details
TYK2 Protein Vector (Mouse) (pPM-C-HA)
48888025 500 ng

TYK2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal Cathepsin Z Antibody (05) [DyLight 350]
NBP3-26880UV 0.1 mL

Mouse Monoclonal Cathepsin Z Antibody (05) [DyLight 350]

Sign In for Pricing
View Details