Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Defensin (human) HNP-2

Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.

Product Specifications

Purity

≥95%

Molecular Weight

3371.02

Notes

For research use only.

AA Sequence

CYCRIPACIAGERRYGTCIYGTCIYQGRLWAFCC (Disulfide bridge: Cys1- Cys29, Cys3- Cys18, Cys8- Cys28)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Alpha-actinin-3, ACTN3 ELISA KIT
ELI-03617b 96 Tests

Bovine Alpha-actinin-3, ACTN3 ELISA KIT

Sign In for Pricing
View Details
Anti-DDX17 Antibody
CQA8695-01 30 µL

Anti-DDX17 Antibody

Sign In for Pricing
View Details
Anti-DDX17 Antibody
CQA8695-02 50 μL

Anti-DDX17 Antibody

Sign In for Pricing
View Details
Anti-DDX17 Antibody
CQA8695-03 100 µL

Anti-DDX17 Antibody

Sign In for Pricing
View Details
Anti-DDX17 Antibody
CQA8695-04 200 µL

Anti-DDX17 Antibody

Sign In for Pricing
View Details
PLGF (Placenta Growth Factor, PlGF2, PGF, PGFL, Placental Growth Factor-Like, Vascular Endothelial Growth Factor-Related Protein)
364687 200 µL

PLGF (Placenta Growth Factor, PlGF2, PGF, PGFL, Placental Growth Factor-Like, Vascular Endothelial Growth Factor-Related Protein)

Sign In for Pricing
View Details