Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Intermedin-53 (human)

Intermedin-53 (human)

Product Specifications

Purity

≥95%

Molecular Weight

5793.61

Notes

For research use only.

AA Sequence

HSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDB1 (CLIM2, LDB-1, LIM Domain-binding Protein 1, Carboxyl-terminal LIM Domain-binding Protein 2, CLIM-2, LIM Domain-binding Factor CLIM2, hLdb1, Nuclear LIM Interactor) (AP) discontinued

129034-AP 100 µL

LDB1 (CLIM2, LDB-1, LIM Domain-binding Protein 1, Carboxyl-terminal LIM Domain-binding Protein 2, CLIM-2, LIM Domain-binding Factor CLIM2, hLdb1, Nuclear LIM Interactor) (AP) discontinued

Sign In for Pricing

Metalloproteinase Inhibitor 1 (TIMP1) Antibody

abx377171-01 50 µg

Metalloproteinase Inhibitor 1 (TIMP1) Antibody

Sign In for Pricing

Metalloproteinase Inhibitor 1 (TIMP1) Antibody

abx377171-02 100 µg

Metalloproteinase Inhibitor 1 (TIMP1) Antibody

Sign In for Pricing

E1A Binding Protein P300 (EP300) Antibody

abx011304 100 µL

E1A Binding Protein P300 (EP300) Antibody

Sign In for Pricing

Mouse Monoclonal Aldolase C Antibody (1A1) [mFluor Violet 500 SE]

NBP2-25144MFV500 0.1 mL

Mouse Monoclonal Aldolase C Antibody (1A1) [mFluor Violet 500 SE]

Sign In for Pricing

Aquaporin 11 (AQP11) Antibody

abx327984-01 50 µg

Aquaporin 11 (AQP11) Antibody

Sign In for Pricing