Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Intermedin-53 (human)

Intermedin-53 (human)

Product Specifications

Purity

≥95%

Molecular Weight

5793.61

Notes

For research use only.

AA Sequence

HSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)
MBS1255031-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)
MBS1255031-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)
MBS1255031-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)
MBS1255031-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)
MBS1255031-05 0.02 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)
MBS1255031-06 0.02 mg (Mammalian-Cell)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 147 protein (mug147)

Sign In for Pricing
View Details