Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr0]-Stresscopin (human)

[Tyr0]-Stresscopin (human)

Product Specifications

Purity

≥95%

Molecular Weight

4530.42

Notes

For research use only.

AA Sequence

YTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EVI1 (MECOM) (N-term) Rabbit Polyclonal Antibody
AP51475PU-N 400 µL

EVI1 (MECOM) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF647 conjugate, 0.1mg/mL
BNC472085-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ESE1 (ELF3) (NM_004433) Human Over-expression Lysate
LY401407 100 µg

ESE1 (ELF3) (NM_004433) Human Over-expression Lysate

Sign In for Pricing
View Details
STAT6 (Solitary Fibrous Tumor Marker) (STAT6/2410), CF488A conjugate, 0.1mg/mL
BNC882410-500 1x 500 µL

STAT6 (Solitary Fibrous Tumor Marker) (STAT6/2410), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IRF2 Polyclonal Antibody
E-AB-61793-01 60 µL

IRF2 Polyclonal Antibody

Sign In for Pricing
View Details
IRF2 Polyclonal Antibody
E-AB-61793-02 120 µL

IRF2 Polyclonal Antibody

Sign In for Pricing
View Details