Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr0]-Stresscopin (human)

[Tyr0]-Stresscopin (human)

Product Specifications

Purity

≥95%

Molecular Weight

4530.42

Notes

For research use only.

AA Sequence

YTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Artemisinic Aldehyde
TRC-A777510-2.5MG 2.5 mg

Artemisinic Aldehyde

Sign In for Pricing
View Details
TAGLN3 (NM_001008273) Human Over-expression Lysate
LY423412 100 µg

TAGLN3 (NM_001008273) Human Over-expression Lysate

Sign In for Pricing
View Details
BMP3 (NM_001201) Human Over-expression Lysate
LY400482 100 µg

BMP3 (NM_001201) Human Over-expression Lysate

Sign In for Pricing
View Details
zinc finger protein 655 (ZNF655) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H9]
TA811672AM 100 µL

zinc finger protein 655 (ZNF655) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H9]

Sign In for Pricing
View Details
5-Ethyl-6-hydroxyhexanoic Acid-d5
TRC-E678617-5MG 5 mg

5-Ethyl-6-hydroxyhexanoic Acid-d5

Sign In for Pricing
View Details
SAP25 Human Gene Knockout Kit (CRISPR)
KN429676 1 Kit

SAP25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details