Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr0]-Stresscopin (human)

[Tyr0]-Stresscopin (human)

Product Specifications

Purity

≥95%

Molecular Weight

4530.42

Notes

For research use only.

AA Sequence

YTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC7 Human Gene Knockout Kit (CRISPR)
KN415233 1 Kit

HDAC7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sdhaf2 (NM_025333) Mouse Tagged ORF Clone
MG201318 10 µg

Sdhaf2 (NM_025333) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Benzarone
TRC-B185150-10MG 10 mg

Benzarone

Sign In for Pricing
View Details
4,5-Dihydroxy-7,10,13,16,19-docosapentaenoic Acid Sodium Salt
TRC-D313140-25MG 25 mg

4,5-Dihydroxy-7,10,13,16,19-docosapentaenoic Acid Sodium Salt

Sign In for Pricing
View Details
Human COA5 activation kit by CRISPRa
GA118576 1 Kit

Human COA5 activation kit by CRISPRa

Sign In for Pricing
View Details
TTLL5 Rabbit Polyclonal Antibody
TA370817 100 µL

TTLL5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details