Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Defensin-3, human

β-Defensin-3, human

Product Specifications

Purity

≥95%

Molecular Weight

5155.22

Notes

For research use only.

AA Sequence

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MK-3328 25mg
A20379-25 25 mg

MK-3328 25mg

Sign In for Pricing
View Details
Slo2.1 Antibody
abx440969 100 µg

Slo2.1 Antibody

Sign In for Pricing
View Details
LOC679566 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV659041 1.0 µg DNA

LOC679566 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Gloeobacter violaceus Putative pterin-4-alpha-carbinolamine dehydratase 1 (gll0926)
MBS1375802-01 0.02 mg (E-Coli)

Recombinant Gloeobacter violaceus Putative pterin-4-alpha-carbinolamine dehydratase 1 (gll0926)

Sign In for Pricing
View Details
Recombinant Gloeobacter violaceus Putative pterin-4-alpha-carbinolamine dehydratase 1 (gll0926)
MBS1375802-02 0.1 mg (E-Coli)

Recombinant Gloeobacter violaceus Putative pterin-4-alpha-carbinolamine dehydratase 1 (gll0926)

Sign In for Pricing
View Details
Recombinant Gloeobacter violaceus Putative pterin-4-alpha-carbinolamine dehydratase 1 (gll0926)
MBS1375802-03 0.02 mg (Yeast)

Recombinant Gloeobacter violaceus Putative pterin-4-alpha-carbinolamine dehydratase 1 (gll0926)

Sign In for Pricing
View Details