Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Defensin-3, human

β-Defensin-3, human

Product Specifications

Purity

≥95%

Molecular Weight

5155.22

Notes

For research use only.

AA Sequence

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ME3 (NM_006680) Human Tagged ORF Clone Lentiviral Particle
RC224151L3V 200 µL

ME3 (NM_006680) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TATDN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2337306 1.0 µg DNA

TATDN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
LRRC69 Lentiviral Activation Particles (m)
sc-428541-LAC 200 µL

LRRC69 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
BMPR1A Rabbit Polyclonal Antibody
TA359374 100 µL

BMPR1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SGLT2/SLC5A2 Antibody [Allophycocyanin]
NBP2-77441APC 0.1 mL

Rabbit Polyclonal SGLT2/SLC5A2 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Ddx47 3'UTR Lenti-reporter-Luc Vector
17846084 1.0 µg

Ddx47 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details