Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldosterone Secretion Inhibiting Factor (1-35) (bovine)

A natriuretic factor isolated from chromaffin cells that is an agonist at NPR receptors that inhibit aldosterone production. Closely related in structure to brain natriuretic peptide (BNP) .

Product Specifications

Field of Research

Pharmacology & Drug Discovery

Purity

≥95%

Molecular Weight

3910.64

Notes

For research use only.

AA Sequence

ALRGPKMMRNDSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge:Cys13-Cys29)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rac- (2R,6S) -2,4,6-Trimethylmorpholine
NBA57443-01 250 mg

Rac- (2R,6S) -2,4,6-Trimethylmorpholine

Sign In for Pricing
View Details
Rac- (2R,6S) -2,4,6-Trimethylmorpholine
NBA57443-02 2.5 g

Rac- (2R,6S) -2,4,6-Trimethylmorpholine

Sign In for Pricing
View Details
NOP58 Antibody, FITC conjugated
A72095-100UG 100 µg

NOP58 Antibody, FITC conjugated

Sign In for Pricing
View Details
HMGB2 Rabbit Polyclonal Antibody (Cy7)
orb1071527 100 µL

HMGB2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
1- (3-Ethoxy-benzyl) -5-oxo-pyrrolidine-3-carboxylic acid
sc-297366 500 mg

1- (3-Ethoxy-benzyl) -5-oxo-pyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
Polyclonal Antibody to Calcineurin Like Phosphoesterase Domain Containing Protein 1 (CPPED1)
TRV-0058549-01 20 µL

Polyclonal Antibody to Calcineurin Like Phosphoesterase Domain Containing Protein 1 (CPPED1)

Sign In for Pricing
View Details