Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldosterone Secretion Inhibiting Factor (1-35) (bovine)

A natriuretic factor isolated from chromaffin cells that is an agonist at NPR receptors that inhibit aldosterone production. Closely related in structure to brain natriuretic peptide (BNP) .

Product Specifications

Field of Research

Pharmacology & Drug Discovery

Purity

≥95%

Molecular Weight

3910.64

Notes

For research use only.

AA Sequence

ALRGPKMMRNDSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge:Cys13-Cys29)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CEP43 Rabbit Monoclonal Antibody, Carrier-free
M06907-carrier-free 100 µL

Anti-CEP43 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
SESN1 (Sestrin 1, PA26, SEST1) (AP)
MBS6437188-01 0.1 mL

SESN1 (Sestrin 1, PA26, SEST1) (AP)

Sign In for Pricing
View Details
SESN1 (Sestrin 1, PA26, SEST1) (AP)
MBS6437188-02 5x 0.1 mL

SESN1 (Sestrin 1, PA26, SEST1) (AP)

Sign In for Pricing
View Details
LOC500354 (NM_001037797) Rat Tagged ORF Clone
RR206281 10 µg

LOC500354 (NM_001037797) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Thermus thermophilus Lysine--tRNA ligase (lysS)
MBS1378180-01 0.02 mg (E-Coli)

Recombinant Thermus thermophilus Lysine--tRNA ligase (lysS)

Sign In for Pricing
View Details
Recombinant Thermus thermophilus Lysine--tRNA ligase (lysS)
MBS1378180-02 0.02 mg (Yeast)

Recombinant Thermus thermophilus Lysine--tRNA ligase (lysS)

Sign In for Pricing
View Details