TIP 39 (39 mer)
TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R) .
Product Specifications
Purity
≥95%
Solubility
Water: 50 mg/mL
Molecular Weight
4504.28
Notes
For research use only.
AA Sequence
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2126520-01 0.1 mL
APC-Linked Polyclonal Antibody to Zinc Finger Homeobox Protein 1A (ZFHX1A)
Sign In for Pricing
View Details MBS2126520-02 0.2 mL
APC-Linked Polyclonal Antibody to Zinc Finger Homeobox Protein 1A (ZFHX1A)
Sign In for Pricing
View Details MBS2126520-03 0.5 mL
APC-Linked Polyclonal Antibody to Zinc Finger Homeobox Protein 1A (ZFHX1A)
Sign In for Pricing
View Details MBS2126520-04 1 mL
APC-Linked Polyclonal Antibody to Zinc Finger Homeobox Protein 1A (ZFHX1A)
Sign In for Pricing
View Details MBS2126520-05 5 mL
APC-Linked Polyclonal Antibody to Zinc Finger Homeobox Protein 1A (ZFHX1A)
Sign In for Pricing
View Details