Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIP 39 (39 mer)

TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R) .

Product Specifications

Purity

≥95%

Solubility

Water: 50 mg/mL

Molecular Weight

4504.28

Notes

For research use only.

AA Sequence

SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AACS Antibody, FITC conjugated
A11473-100UG 100 µg

AACS Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse Akap1 activation kit by CRISPRa
GA200143 1 Kit

Mouse Akap1 activation kit by CRISPRa

Sign In for Pricing
View Details
Lentiviral human RHBDL3 shRNA (UAS) - Lentiviral human RHBDL3 shRNA (UAS, GFP) (100)
GTR15108633 1 Vial

Lentiviral human RHBDL3 shRNA (UAS) - Lentiviral human RHBDL3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-MARVELD3 antibody
PAab05018 100 µg

Anti-MARVELD3 antibody

Sign In for Pricing
View Details
KIAA1967 Rabbit pAb
APA4032-01 30 µL

KIAA1967 Rabbit pAb

Sign In for Pricing
View Details
KIAA1967 Rabbit pAb
APA4032-02 50 μL

KIAA1967 Rabbit pAb

Sign In for Pricing
View Details