Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIP 39 (39 mer)

TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R) .

Product Specifications

Purity

≥95%

Solubility

Water: 50 mg/mL

Molecular Weight

4504.28

Notes

For research use only.

AA Sequence

SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Innovative Grade US Origin Horse Plasma Na Citrate 1000ml
IGHSPLANAC1000ML 1000 mL

Innovative Grade US Origin Horse Plasma Na Citrate 1000ml

Sign In for Pricing
View Details
C3 Rabbit Monoclonal Antibody
AMRe85365-01 1 Each

C3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
C3 Rabbit Monoclonal Antibody
AMRe85365-02 50 µL

C3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
C3 Rabbit Monoclonal Antibody
AMRe85365-03 100 µL

C3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Presenilin 1 (PS1) ELISA Kit
orb1947283-01 48 Tests

Mouse Presenilin 1 (PS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Presenilin 1 (PS1) ELISA Kit
orb1947283-02 96 Tests

Mouse Presenilin 1 (PS1) ELISA Kit

Sign In for Pricing
View Details