Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Charybdotoxin

Charybdotoxin

Product Specifications

Purity

≥95%

Molecular Weight

4295.98

Notes

For research use only.

AA Sequence

{Glp}-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridges:Cys7-Cys28, Cys13-Cys33, Cys17-Cys35)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-6511b-5p miRNA Antagomir
MNH03335 2x 5.0 nmol

hsa-miR-6511b-5p miRNA Antagomir

Sign In for Pricing
View Details
PMP2 Antibody, Biotin conjugated
CSB-PA315130LD01HO-01 50 µg

PMP2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PMP2 Antibody, Biotin conjugated
CSB-PA315130LD01HO-02 100 µg

PMP2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CTGE4, NT (CTAGE4, Cutaneous T-cell lymphoma-associated antigen 4) (AP) discontinued
034329-AP 200 µL

CTGE4, NT (CTAGE4, Cutaneous T-cell lymphoma-associated antigen 4) (AP) discontinued

Sign In for Pricing
View Details
MEL-1B-R Antibody
orb2626284 100 µL

MEL-1B-R Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus pyogenes serotype M1 Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)
MBS1381593-01 0.02 mg (E-Coli)

Recombinant Streptococcus pyogenes serotype M1 Methylenetetrahydrofolate--tRNA- (uracil-5-) -methyltransferase TrmFO (trmFO)

Sign In for Pricing
View Details