Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Charybdotoxin

Charybdotoxin

Product Specifications

Purity

≥95%

Molecular Weight

4295.98

Notes

For research use only.

AA Sequence

{Glp}-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridges:Cys7-Cys28, Cys13-Cys33, Cys17-Cys35)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General Advanced Glycation End Product (AGE) ELISA Kit
orb1946669-01 48 Tests

General Advanced Glycation End Product (AGE) ELISA Kit

Sign In for Pricing
View Details
General Advanced Glycation End Product (AGE) ELISA Kit
orb1946669-02 96 Tests

General Advanced Glycation End Product (AGE) ELISA Kit

Sign In for Pricing
View Details
3,5-Bis (tert-butyl) benzaldehyde
263579-01 1 g

3,5-Bis (tert-butyl) benzaldehyde

Sign In for Pricing
View Details
3,5-Bis (tert-butyl) benzaldehyde
263579-02 2 g

3,5-Bis (tert-butyl) benzaldehyde

Sign In for Pricing
View Details
3,5-Bis (tert-butyl) benzaldehyde
263579-03 5 g

3,5-Bis (tert-butyl) benzaldehyde

Sign In for Pricing
View Details
3,5-Bis (tert-butyl) benzaldehyde
263579-04 10 g

3,5-Bis (tert-butyl) benzaldehyde

Sign In for Pricing
View Details