Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5a Anaphylatoxin (human)

C5a Anaphylatoxin (human)

Product Specifications

Purity

≥95%

Notes

For research use only.

AA Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Bridging Integrator 2 (BIN2) ELISA Kit
DLR-BIN2-Hu-01 48 Tests

Human Bridging Integrator 2 (BIN2) ELISA Kit

Sign In for Pricing
View Details
Human Bridging Integrator 2 (BIN2) ELISA Kit
DLR-BIN2-Hu-02 96 Tests

Human Bridging Integrator 2 (BIN2) ELISA Kit

Sign In for Pricing
View Details
HIST1H1D Protein Vector (Mouse) (pPM-C-His)
PV188729 500 ng

HIST1H1D Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MafG CRISPR Activation Plasmid (m)
sc-421533-ACT 20 µg

MafG CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
FAM46B (TENT5B) (NM_052943) Human Tagged Lenti ORF Clone
RC203640L3 10 µg

FAM46B (TENT5B) (NM_052943) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans atg-13 Polyclonal Antibody
MBS7159049 Inquire

Rabbit anti-Caenorhabditis elegans atg-13 Polyclonal Antibody

Sign In for Pricing
View Details