Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5a Anaphylatoxin (human)

C5a Anaphylatoxin (human)

Product Specifications

Purity

≥95%

Notes

For research use only.

AA Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Peroxiredoxin 3 (PRDX3) ELISA Kit
MBS9391138 Inquire

Donkey Peroxiredoxin 3 (PRDX3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SCFD1 Protein, N-His
orb2833639-01 20 µg

Recombinant Human SCFD1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SCFD1 Protein, N-His
orb2833639-02 50 µg

Recombinant Human SCFD1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SCFD1 Protein, N-His
orb2833639-03 100 µg

Recombinant Human SCFD1 Protein, N-His

Sign In for Pricing
View Details
Rabbit anti-Homo sapiens (Human) RPL35 Polyclonal Antibody
MBS7142935 Inquire

Rabbit anti-Homo sapiens (Human) RPL35 Polyclonal Antibody

Sign In for Pricing
View Details
DTWD1 Knockout A2780 Polyclonal Cells
ARG39919 1 Million

DTWD1 Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details