Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5a Anaphylatoxin (human)

C5a Anaphylatoxin (human)

Product Specifications

Purity

≥95%

Notes

For research use only.

AA Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKF 83566 hydrobromide
MBS5757827 Inquire

SKF 83566 hydrobromide

Sign In for Pricing
View Details
Human IL34 Recombinant Protein N-His Tag Lyophilized 100UG
IHUIL34RNHISLY100UG 100 µg

Human IL34 Recombinant Protein N-His Tag Lyophilized 100UG

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative gustatory receptor 8a (Gr8a)
MBS7016349-01 0.02 mg

Recombinant Drosophila melanogaster Putative gustatory receptor 8a (Gr8a)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative gustatory receptor 8a (Gr8a)
MBS7016349-02 0.1 mg

Recombinant Drosophila melanogaster Putative gustatory receptor 8a (Gr8a)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative gustatory receptor 8a (Gr8a)
MBS7016349-03 5x 0.1 mg

Recombinant Drosophila melanogaster Putative gustatory receptor 8a (Gr8a)

Sign In for Pricing
View Details
EGFR pTyr1173 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9H2]
AM00042PU-N 100 µg

EGFR pTyr1173 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9H2]

Sign In for Pricing
View Details