Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Copeptin (rat)

Copeptin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

4281.74

Notes

For research use only.

AA Sequence

AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse M-CSF/CSF1 Protein
PKSM041111-01 10 µg

Recombinant Mouse M-CSF/CSF1 Protein

Sign In for Pricing
View Details
Recombinant Mouse M-CSF/CSF1 Protein
PKSM041111-02 50 µg

Recombinant Mouse M-CSF/CSF1 Protein

Sign In for Pricing
View Details
Anti-ISLR
Y058879 100 µg

Anti-ISLR

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF405S conjugate, 0.1mg/mL
BNC040818-100 1x 100 µL

CD45RA (PTPRC/818), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fixed Volume Single Channel Micropipette BPIP-541
BPIP-541 1 Unit

Fixed Volume Single Channel Micropipette BPIP-541

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF647 conjugate, 0.1mg/mL
BNC471671-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1671), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details