Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Copeptin (rat)

Copeptin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

4281.74

Notes

For research use only.

AA Sequence

AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MEF-2C protein (His tag)
PDEH101038-01 20 µg

Recombinant Human MEF-2C protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MEF-2C protein (His tag)
PDEH101038-02 100 µg

Recombinant Human MEF-2C protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MEF-2C protein (His tag)
PDEH101038-03 500 µg

Recombinant Human MEF-2C protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MEF-2C protein (His tag)
PDEH101038-04 1 mg

Recombinant Human MEF-2C protein (His tag)

Sign In for Pricing
View Details
CHRDL2 (NM_001278473) Human Tagged ORF Clone
RG238180 10 µg

CHRDL2 (NM_001278473) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human MTG1 activation kit by CRISPRa
GA114188 1 Kit

Human MTG1 activation kit by CRISPRa

Sign In for Pricing
View Details