Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Copeptin (rat)

Copeptin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

4281.74

Notes

For research use only.

AA Sequence

AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bax (BAX/962), CF647 conjugate, 0.1mg/mL
BNC470962-500 1x 500 µL

Bax (BAX/962), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PAX8 Monoclonal Antibody
AN301620L-01 50 µL

Recombinant PAX8 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PAX8 Monoclonal Antibody
AN301620L-02 100 µL

Recombinant PAX8 Monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
E-AB-F1191M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
E-AB-F1191M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
E-AB-F1191M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]

Sign In for Pricing
View Details