Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Copeptin (rat)

Copeptin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

4281.74

Notes

For research use only.

AA Sequence

AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASPH Polyclonal Antibody
E-AB-90587-01 60 µL

ASPH Polyclonal Antibody

Sign In for Pricing
View Details
ASPH Polyclonal Antibody
E-AB-90587-02 120 µL

ASPH Polyclonal Antibody

Sign In for Pricing
View Details
ASPH Polyclonal Antibody
E-AB-90587-03 200 µL

ASPH Polyclonal Antibody

Sign In for Pricing
View Details
ME3 Antibody
8C16864-AAT 50 µg

ME3 Antibody

Sign In for Pricing
View Details
GLPK3 Antibody
8C11031-AAT 50 µg

GLPK3 Antibody

Sign In for Pricing
View Details
APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), Biotin conjugate, 0.1mg/mL
BNCB3076-100 1x 100 µL

APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details