Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Copeptin (rat)

Copeptin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Product Specifications

Purity

≥95%

Molecular Weight

4281.74

Notes

For research use only.

AA Sequence

AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAP (Placental Alkaline Phosphatase) (GM022), CF660R conjugate, 0.1mg/mL
BNC610874-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Triacontylamine Hydrochloride
TRC-T767060-50MG 50 mg

1-Triacontylamine Hydrochloride

Sign In for Pricing
View Details
Myoglobin (Muscle Cell Marker) (rMB/2105), CF647 conjugate, 0.1mg/mL
BNC473800-500 1x 500 µL

Myoglobin (Muscle Cell Marker) (rMB/2105), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pentoxyverine Citrate
TRC-P276600-1G 1 g

Pentoxyverine Citrate

Sign In for Pricing
View Details
PIAS3 Polyclonal Antibody
E-AB-17823-01 20 µL

PIAS3 Polyclonal Antibody

Sign In for Pricing
View Details
PIAS3 Polyclonal Antibody
E-AB-17823-02 60 µL

PIAS3 Polyclonal Antibody

Sign In for Pricing
View Details