Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Glu8·9) -Helodermin

(Glu8·9) -Helodermin has been isolated from the salivary gland of the Gila monster Heloderma suspectum. It consists of 35 amino acids and shares 53 and 42% homology with human pituitary adenylate cyclase activating polypeptide (PACAP) and vasoactive intestinal peptide (VIP), respectively. It was shown to have high affinity for the mammalian VIP2 receptor and equal potency and efficacy for stimulating cAMP production compared with mammalian VIP and PACAP. Even a helodermin-preferring receptor has been described. Furthermore, immunohistochemical studies, using antibodies that did not cross-react with mammalian VIP or PACAP or other known members of the GLP-1 / VIP / PACAP peptide family suggested the existence of a mammalian homologue to (Glu8·9) -Helodermin distinct from VIP and PACAP.

Product Specifications

Purity

≥95%

Molecular Weight

3845.46

Notes

For research use only.

AA Sequence

HSDAIFTEEYSKLLAKLALQKYLASILSRTSPPP-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCALD (NM_032041) Human Tagged ORF Clone Lentiviral Particle
RC214659L4V 200 µL

NCALD (NM_032041) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lyst (NM_053518) Rat Tagged ORF Clone
RR211385 10 µg

Lyst (NM_053518) Rat Tagged ORF Clone

Sign In for Pricing
View Details
CD40LG Polyclonal Antibody
A70581-050 50 µL

CD40LG Polyclonal Antibody

Sign In for Pricing
View Details
GPR1 siRNA (m)
sc-60724 10 µM

GPR1 siRNA (m)

Sign In for Pricing
View Details
PKP1 (Plakophilin 1, B6P, Ectodermal Dysplasia/Skin Fragility Syndrome)
364665 200 µL

PKP1 (Plakophilin 1, B6P, Ectodermal Dysplasia/Skin Fragility Syndrome)

Sign In for Pricing
View Details
Vmn1r205 3'UTR GFP Stable Cell Line
TU171870 1.0 mL

Vmn1r205 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details