Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Glu8·9) -Helodermin

(Glu8·9) -Helodermin has been isolated from the salivary gland of the Gila monster Heloderma suspectum. It consists of 35 amino acids and shares 53 and 42% homology with human pituitary adenylate cyclase activating polypeptide (PACAP) and vasoactive intestinal peptide (VIP), respectively. It was shown to have high affinity for the mammalian VIP2 receptor and equal potency and efficacy for stimulating cAMP production compared with mammalian VIP and PACAP. Even a helodermin-preferring receptor has been described. Furthermore, immunohistochemical studies, using antibodies that did not cross-react with mammalian VIP or PACAP or other known members of the GLP-1 / VIP / PACAP peptide family suggested the existence of a mammalian homologue to (Glu8·9) -Helodermin distinct from VIP and PACAP.

Product Specifications

Purity

≥95%

Molecular Weight

3845.46

Notes

For research use only.

AA Sequence

HSDAIFTEEYSKLLAKLALQKYLASILSRTSPPP-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSRNP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
16964066 1.0 µg DNA

CSRNP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Orai1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6678306 1.0 µg DNA

Orai1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Dusp12 (NM_022248) Rat Tagged ORF Clone Lentiviral Particle
RR205241L3V 200 µL

Dusp12 (NM_022248) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CEBPG Antibody
E11-10718C 100 µg

CEBPG Antibody

Sign In for Pricing
View Details
GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1) (MaxLight 490)
MBS6201139-01 0.1 mL

GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1) (MaxLight 490)

Sign In for Pricing
View Details
GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1) (MaxLight 490)
MBS6201139-02 5x 0.1 mL

GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1) (MaxLight 490)

Sign In for Pricing
View Details