Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Glu8·9) -Helodermin

(Glu8·9) -Helodermin has been isolated from the salivary gland of the Gila monster Heloderma suspectum. It consists of 35 amino acids and shares 53 and 42% homology with human pituitary adenylate cyclase activating polypeptide (PACAP) and vasoactive intestinal peptide (VIP), respectively. It was shown to have high affinity for the mammalian VIP2 receptor and equal potency and efficacy for stimulating cAMP production compared with mammalian VIP and PACAP. Even a helodermin-preferring receptor has been described. Furthermore, immunohistochemical studies, using antibodies that did not cross-react with mammalian VIP or PACAP or other known members of the GLP-1 / VIP / PACAP peptide family suggested the existence of a mammalian homologue to (Glu8·9) -Helodermin distinct from VIP and PACAP.

Product Specifications

Purity

≥95%

Molecular Weight

3845.46

Notes

For research use only.

AA Sequence

HSDAIFTEEYSKLLAKLALQKYLASILSRTSPPP-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LECT1 Antibody, Biotin conjugated
MBS1494459-01 0.05 mg

LECT1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
LECT1 Antibody, Biotin conjugated
MBS1494459-02 0.1 mg

LECT1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
LECT1 Antibody, Biotin conjugated
MBS1494459-03 5x 0.1 mg

LECT1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
2- (Pyrrolidin-1-yl) pyridine-4-carboxaldehyde
sc-259355 50 mg

2- (Pyrrolidin-1-yl) pyridine-4-carboxaldehyde

Sign In for Pricing
View Details
RBMY2BP sgRNA CRISPR Lentivector (Human) (Target 3)
K1798604 1.0 µg DNA

RBMY2BP sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Biotin-Linked Anti-Kidney Injury Molecule 1 (KIM1)
FY-AB42604-01 1 mL

Biotin-Linked Anti-Kidney Injury Molecule 1 (KIM1)

Sign In for Pricing
View Details