Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Glu13·17·20) -Osteocalcin (1-46) (mouse)

(Glu13,17,20) -Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46) . Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

5114.67

Notes

For research use only.

AA Sequence

YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI (Disulfide bridge: Cys19-Cys25)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HSP90B1 qPCR Primer Pair
QH24349S 200 Tests

Human HSP90B1 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium leuB Protein (aa 1-336)
VAng-Yyj2586-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Avium leuB Protein (aa 1-336)

Sign In for Pricing
View Details
Mouse Monoclonal Hexanoyl-Lysine adduct Antibody (5D9) [DyLight 488]
NBP2-59362G 100 µL

Mouse Monoclonal Hexanoyl-Lysine adduct Antibody (5D9) [DyLight 488]

Sign In for Pricing
View Details
CDK1   monoclonal antibody
MB10713 50ul

CDK1 monoclonal antibody

Sign In for Pricing
View Details
Human Mercaptopyruvate Sulfurtransferase (MPST) Protein
abx073378-01 5 µg

Human Mercaptopyruvate Sulfurtransferase (MPST) Protein

Sign In for Pricing
View Details
Human Mercaptopyruvate Sulfurtransferase (MPST) Protein
abx073378-02 20 µg

Human Mercaptopyruvate Sulfurtransferase (MPST) Protein

Sign In for Pricing
View Details