Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Glu13·17·20) -Osteocalcin (1-46) (mouse)

(Glu13,17,20) -Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46) . Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

5114.67

Notes

For research use only.

AA Sequence

YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI (Disulfide bridge: Cys19-Cys25)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TI17
E1924-100mg 100 mg

TI17

Sign In for Pricing
View Details
Human CLIC3 Matched Antibody Pair Set [ABP-Q-0495]
ABP-Q-0495 5 Plates

Human CLIC3 Matched Antibody Pair Set [ABP-Q-0495]

Sign In for Pricing
View Details
Mouse Monoclonal MUC1 Antibody (604804) [Janelia Fluor 525]
FAB6298JF525 0.1 mL

Mouse Monoclonal MUC1 Antibody (604804) [Janelia Fluor 525]

Sign In for Pricing
View Details
Rabbit Cardiac Troponin I (cTnI) ELISA Kit
EKU08432 96 Tests

Rabbit Cardiac Troponin I (cTnI) ELISA Kit

Sign In for Pricing
View Details
CXCR4 discontinued
387986 200 µL

CXCR4 discontinued

Sign In for Pricing
View Details
Hamster Monoclonal Helios Antibody (22F6) [Alexa Fluor 488]
NBP2-37723AF488 0.1 mL

Hamster Monoclonal Helios Antibody (22F6) [Alexa Fluor 488]

Sign In for Pricing
View Details