Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Glu13·17·20) -Osteocalcin (1-46) (mouse)

(Glu13,17,20) -Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46) . Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

5114.67

Notes

For research use only.

AA Sequence

YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI (Disulfide bridge: Cys19-Cys25)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal MUC1 Antibody (MUC1/8109R) [Biotin]
NBP3-20775B 0.1 mL

Rabbit Monoclonal MUC1 Antibody (MUC1/8109R) [Biotin]

Sign In for Pricing
View Details
TXNDC17 (Thioredoxin Domain Containing 17, TRP14, TXNL5) (FITC)
MBS6442042-01 0.1 mL

TXNDC17 (Thioredoxin Domain Containing 17, TRP14, TXNL5) (FITC)

Sign In for Pricing
View Details
TXNDC17 (Thioredoxin Domain Containing 17, TRP14, TXNL5) (FITC)
MBS6442042-02 5x 0.1 mL

TXNDC17 (Thioredoxin Domain Containing 17, TRP14, TXNL5) (FITC)

Sign In for Pricing
View Details
STIM1 Rabbit Polyclonal Antibody (Cy7)
orb1034199 100 µL

STIM1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
KPNA3 CRISPRa sgRNA lentivector (set of three targets)(Human)
25901121 3x 1.0µg DNA

KPNA3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
H-D-Leu-oet hydrochloride
OR964283-01 5 g

H-D-Leu-oet hydrochloride

Sign In for Pricing
View Details