Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Glu13·17·20) -Osteocalcin (1-46) (mouse)

(Glu13,17,20) -Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46) . Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

5114.67

Notes

For research use only.

AA Sequence

YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI (Disulfide bridge: Cys19-Cys25)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Periostin/OSF-2 Antibody (POSTN/8523R) [Alexa Fluor 594]
NBP3-20922AF594 0.1 mL

Rabbit Monoclonal Periostin/OSF-2 Antibody (POSTN/8523R) [Alexa Fluor 594]

Sign In for Pricing
View Details
Klk12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
25814114 3x 1.0 µg

Klk12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CD138, CT (K281) (SDC1, SDC, Syndecan-1, CD138) (MaxLight 490) discontinued
033458-ML490 100 µL

CD138, CT (K281) (SDC1, SDC, Syndecan-1, CD138) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ADAMTS6 Antibody (N-Term)
MBS9206658-01 0.08 mL

ADAMTS6 Antibody (N-Term)

Sign In for Pricing
View Details
ADAMTS6 Antibody (N-Term)
MBS9206658-02 0.4 mL

ADAMTS6 Antibody (N-Term)

Sign In for Pricing
View Details
ADAMTS6 Antibody (N-Term)
MBS9206658-03 5x 0.4 mL

ADAMTS6 Antibody (N-Term)

Sign In for Pricing
View Details