Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(D-Trp2) -Galanin (1-29) (human)

(D-Trp2) -Galanin (1-29) (human)

Product Specifications

Purity

≥95%

Molecular Weight

3210.52

Notes

For research use only.

AA Sequence

G-{D-Trp}-TLNSAGYLLGYLLGPHAVGNHRSFSDKNGLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR20D (NM_001130406) Human Over-expression Lysate
LC427200 20 µg

PRR20D (NM_001130406) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2115), 1mg/mL
BNUM2115-50 1x 50 µL

Cytokeratin 8 (KRT8) (KRT8/2115), 1mg/mL

Sign In for Pricing
View Details
Tau (S324) Antibody
KC-42344-01 50 μL

Tau (S324) Antibody

Sign In for Pricing
View Details
Tau (S324) Antibody
KC-42344-02 100 µL

Tau (S324) Antibody

Sign In for Pricing
View Details
Tau (S324) Antibody
KC-42344-03 1 mL

Tau (S324) Antibody

Sign In for Pricing
View Details
N'-Hydroxypyridine-3-carboximidamide
TRC-H953750-2.5G 2.5 g

N'-Hydroxypyridine-3-carboximidamide

Sign In for Pricing
View Details