Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(D-Trp2) -Galanin (1-29) (human)

(D-Trp2) -Galanin (1-29) (human)

Product Specifications

Purity

≥95%

Molecular Weight

3210.52

Notes

For research use only.

AA Sequence

G-{D-Trp}-TLNSAGYLLGYLLGPHAVGNHRSFSDKNGLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF647 conjugate, 0.1mg/mL
BNC472303-100 1x 100 µL

Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RANBP3 (N-term) Rabbit Polyclonal Antibody
AP53575PU-N 400 µL

RANBP3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (AE-2), 0.2mg/mL
BNUB0946-500 1x 500 µL

Double Stranded DNA (dsDNA) (AE-2), 0.2mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF568 conjugate, 0.1mg/mL
BNC681366-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), 0.2mg/mL
BNUB0173-100 1x 100 µL

CD45 / LCA (136-4B5), 0.2mg/mL

Sign In for Pricing
View Details
MEAK7 (TLDC1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B1]
TA501057AM 100 µL

MEAK7 (TLDC1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B1]

Sign In for Pricing
View Details