Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(D-Trp2) -Galanin (1-29) (human)

(D-Trp2) -Galanin (1-29) (human)

Product Specifications

Purity

≥95%

Molecular Weight

3210.52

Notes

For research use only.

AA Sequence

G-{D-Trp}-TLNSAGYLLGYLLGPHAVGNHRSFSDKNGLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZPCK (SL-01)
SIH-343-50MG 50 mg

ZPCK (SL-01)

Sign In for Pricing
View Details
6-amino-5-chloro-2-cyclopropylpyrimidine-4-carboxylic Acid
TRC-A605775-1MG 1 mg

6-amino-5-chloro-2-cyclopropylpyrimidine-4-carboxylic Acid

Sign In for Pricing
View Details
ROR2 Rabbit Monoclonal Antibody
TA423760 100 µL

ROR2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SAGE1 Recombinant Rabbit Monoclonal Antibody [PSH05-89]
HA722487 100 µL

SAGE1 Recombinant Rabbit Monoclonal Antibody [PSH05-89]

Sign In for Pricing
View Details
Recombinant PKC alpha Antibody
RC-7045-01 50 μL

Recombinant PKC alpha Antibody

Sign In for Pricing
View Details
Recombinant PKC alpha Antibody
RC-7045-02 100 µL

Recombinant PKC alpha Antibody

Sign In for Pricing
View Details