Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (human)

Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

6500.28

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcineurin A / PPP3CA (CALNA/2353), CF405S conjugate, 0.1mg/mL
BNC042353-100 1x 100 µL

Calcineurin A / PPP3CA (CALNA/2353), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neuropeptide Y Recombinant Rabbit monoclonal Antibody
HA723885B 100 µL

Neuropeptide Y Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
INSIG1 Human Gene Knockout Kit (CRISPR)
KN400312 1 Kit

INSIG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GALR1 (NM_001480) Human Over-expression Lysate
LY419921 100 µg

GALR1 (NM_001480) Human Over-expression Lysate

Sign In for Pricing
View Details
MDA5 Antibody
KC-222-01 50 μL

MDA5 Antibody

Sign In for Pricing
View Details
MDA5 Antibody
KC-222-02 100 µL

MDA5 Antibody

Sign In for Pricing
View Details