Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (human)

Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

6500.28

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 5 (KLK5) (NM_001077492) Human Over-expression Lysate
LC421443 20 µg

Kallikrein 5 (KLK5) (NM_001077492) Human Over-expression Lysate

Sign In for Pricing
View Details
SOCS1 Polyclonal Antibody
E-AB-15855-01 20 µL

SOCS1 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS1 Polyclonal Antibody
E-AB-15855-02 60 µL

SOCS1 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS1 Polyclonal Antibody
E-AB-15855-03 120 µL

SOCS1 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS1 Polyclonal Antibody
E-AB-15855-04 200 µL

SOCS1 Polyclonal Antibody

Sign In for Pricing
View Details
TTC32 (NM_001008237) Human Over-expression Lysate
LY423407 100 µg

TTC32 (NM_001008237) Human Over-expression Lysate

Sign In for Pricing
View Details