Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (human)

Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

6500.28

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2763), CF740 conjugate, 0.1mg/mL
BNC742763-100 1x 100 µL

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2763), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit
E-OSEL-M0018-01 24 Tests

QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit
E-OSEL-M0018-02 48 Tests

QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit
E-OSEL-M0018-03 96 Tests

QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit

Sign In for Pricing
View Details
Human C1orf150 (GCSAmL) activation kit by CRISPRa
GA115687 1 Kit

Human C1orf150 (GCSAmL) activation kit by CRISPRa

Sign In for Pricing
View Details
Eurycomanone
TRC-E939010-25MG 25 mg

Eurycomanone

Sign In for Pricing
View Details